ω-Tbo-IT1

Selective blocker of insects calcium channels

ω-Tbo-IT1 has been isolated from the venom of the Tibellus oblongus spider. ω-Tbo-IT1 is a selective blocker of insects calcium channels. It has been shown that ω-Tbo-IT1 has a potent insect toxicity with LD50 19 μg/g on house fly Musca domestica larvae and LD50 20 μg/g on juvenile Gromphadorhina portentosa cockroaches. Electrophysiological experiments revealed a reversible inhibition of evoked excitatory postsynaptic currents in blow fly Calliphora vicina neuromuscular junctions with an IC50 value 40 ± 10 nM.

 

Change currency
Clear
Product code: ITO001. Category: .

AA sequence: CASKNERCGNALYGTKGPGCCNGKCICRTVPRKGVNSCRCM
Disulfide bonds: Cys1-Cys21; Cys8-Cys25; Cys20-Cys40
Length (aa): 41
Formula: C171H285N61O53S9
Molecular Weight: 4331,74 g/mol
CAS number: NA
Source: Synthetic
Purity rate: > 95 %

ω-Tbo-IT1–New Inhibitor of Insect Calcium Channels Isolated from Spider Venom