Cy3-Crotamine

Fluorescent tumor-cell specific agent

Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types such as tumor cells. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

Cy3-crotamine is a fluorescent version of Crotamine.

Free sample Recently quoted
Change currency
Clear
Product code: CRO002. Category: .

AA sequence: YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
Disulfide bridges: Cys4-Cys36; Cys11-Cys30; Cys18-Cys37
Length (aa): 41
Formula: C214H326N64O54S7
Molecular Weight: 4883.82 Da
Cy3: λex 555 nm / λem 570 nm
Source: synthetic
Purity rate: > 95 %

Characterization of ribonucleic acids from the venom glands of Crotalus durissus terrifucus
The analgesic activity of crotamine, a neurotoxin from Crotalus durissus terrificus
Crotamine is a novel cell-penetrating protein from the venom of rattlesnake Crotalus durissus terrificus
Biological versatility of crotamine a cationic peptide from the venom of a South American rattlesnake

State of the art in the studies on crotamine, a cell penetrating peptide from South American rattlesnake

The natural cell-penetrating peptide crotamine targets tumor tissue in vivo and triggers a lethal calcium-dependent pathway in cultured cells.

Crotamine: a novel cell-penetrating polypeptide nanocarrier with potential anti-cancer and biotechnological applications.