GrTx1

GrTx1 toxin is a peptide originally isolated from the venom of the spider Grammostola rosea. GrTx1 preferentially blocks voltage-gated sodium channels.

GrTx1 toxin is in the same cluster than other famous sodium channel blockers such as ProTx-II, GsAF-1 and GsAF-2. GrTx1 potently and selectively blocks tetrodotoxin-sensivite channels. IC50 values for Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7 have respectively been described to be of 0.63 µM, 0.23 µM, 0.77 µM, 1.29 µM, 0.63 µM and 0.37 µM.

Free sample
Change currency
Clear
Product code: GRX. Category: . Tag: .

AA sequence: YCQKWMWTCDSKRKCCEDMVCQLWCKKRL-OH
Disulfide bonds: Cys6-Cys16, Cys9-Cys21 and Cys15-Cys25
Length (AA): 29
Formula: C159H243N45O41S8
Molecular Weight: 3697,49 Da
Appearance: White lyophilized solid
Solubility: water
CAS number:
Source: Synthetic
Purity rate: > 95 %