Tf2 scorpion toxin

Tf2 is a potent Nav1.3 activator

Tf2 was originally isolated from the venom of the Brazilian scorpion Tityus fasciolatus. This β-scorpion peptide toxin has been described potently potentiate Nav1.3 opening at 1µm without affecting other Nav isorforms.

Change currency
Clear
Product code: TFX002. Category: . Tag: .

AA sequence: KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC-NH2
Disulfide bonds: Cys1-Cys8, Cys2-Cys5, Cys3-Cys6, Cys4-Cys7
Length (aa): 62
Formula: C309H438N80O87S9
Molecular Weight: 6953.86 Da
Appearance: White lyophilized solid
Solubility: water or saline buffer
CAS number: NA
Source: Synthetic
Purity rate: > 95 %

The Scorpion Toxin Tf2 from Tityus fasciolatus Promotes Nav1.3 Opening