AA sequence: KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC-NH2
Disulfide bonds: Cys1-Cys8, Cys2-Cys5, Cys3-Cys6, Cys4-Cys7
Length (aa): 62
Formula: C309H438N80O87S9
Molecular Weight: 6953.86 Da
Appearance: White lyophilized solid
Solubility: water or saline buffer
CAS number: NA
Source: Synthetic
Purity rate: > 95 %
Tf2 scorpion toxin
Tf2 is a potent Nav1.3 activator
Tf2 was originally isolated from the venom of the Brazilian scorpion Tityus fasciolatus. This β-scorpion peptide toxin has been described potently potentiate Nav1.3 opening at 1µm without affecting other Nav isorforms.
The Scorpion Toxin Tf2 from Tityus fasciolatus Promotes Nav1.3 Opening
We identified Tf2, the first β-scorpion toxin from the venom of the Brazilian scorpion Tityus fasciolatus. Tf2 is identical to Tb2-II found in Tityus bahiensis. We found that Tf2 selectively activates human (h)Nav1.3, a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Tf2 shifts hNav1.3 activation voltage to more negative values, thereby opening the channel at resting membrane potentials. Seven other tested mammalian Nav channels (Nav1.1-1.2; Nav1.4-1.8) expressed in Xenopus oocytes are insensitive upon application of 1 μM Tf2. Therefore, the identification of Tf2 represents a unique addition to the repertoire of animal toxins that can be used to investigate Nav channel function.
Camargos T., et al. (2015) doi: 10.1371/journal.pone.0128578 , PMID: 26083731