Phlotoxin-1

Phlotoxin-1 is a potent blocker of Nav1.7 channel

Phlotoxin-1 is a new member of the NaSpTx-1 family. Phlotoxin-1 has been purified originally from the venom of Phlogiellus sp., Theraphosidae Selenocosmiinae (endemic to Papua New Guinea). Phlotoxin-1 inhibits Nav1.7 with an IC50 value of 39 ± 2 nM.

Biossay results

Photoxin-1 inhibition of Nav1.7 channels expressed in a mammalian cell line. Average dose-response curve of hNav1.7 current block by Photoxin-1. A sigmoid Hill fit provides an IC50 value of 39 ± 2 nM and a Hill value of 1.53. Numbers of cells per concentration: 4 to 8.

Free sample
Change currency
Clear
Product code: PHX001. Category: .

AA sequence: ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF
Disulfide bonds: Cys1-Cys4, Cys2-Cys5, Cys3-Cys6
Length (aa): 34
Formula: C183H254N46O48S6
Molecular Weight: 4058.73 g/mol
CAS number:
Source: Synthetic
Purity rate: > 95 %